PDB entry 1gso

View 1gso on RCSB PDB site
Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.
Deposited on 1998-09-08, released 1998-12-09
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-05, with a file datestamp of 2000-05-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gsoA (A:)
    efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
    faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqlegskaftkdflarhkip
    taeyqnftevepalaylrekgapivikadglaagkgvivamtleeaeaavhdmlagnafg
    daghrivieefldgeeasfivmvdgehvlpmatsqdhkrvgdkdtgpntggmgayspapv
    vtddvhqrtmeriiwptvkgmaaegntytgflyaglmidkqgnpkviefncrfgdletqp
    imlrmksdlvelclaaceskldektsewderaslgvvmaaggypgdyrtgdvihglplee
    vaggkvfhagtkladdeqvvtnggrvlcvtalghtvaeaqkrayalmtdihwddcfcrkd
    igwraier
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gsoA (A:)
    efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
    faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqlegskaftkdflarhkip
    taeyqnftevepalaylrekgapivikakgvivamtleeaeaavhdmlagnafgdaghri
    vieefldgeeasfivmvdgehvlpmatsqdhkrvgdkdtgpntggmgayspapvvtddvh
    qrtmeriiwptvkgmaaegntytgflyaglmidkqgnpkviefncrfgdletqpimlrmk
    sdlvelclaaceskldektsewderaslgvvmaaggypgdyrtgdvihglpleevaggkv
    fhagtklaqvvtnggrvlcvtalghtvaeaqkrayalmtdihwddcfcrkdigwraier