PDB entry 1gsm

View 1gsm on RCSB PDB site
Description: a reassessment of the madcam-1 structure and its role in integrin recognition.
Class: cell adhesion protein
Keywords: cell adhesion protein, madcam-1, immunoglobulin fold, I-set fold, cell adhesion glycoprotein, integrin recoginition, membrane protein
Deposited on 2002-01-08, released 2002-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mucosal addressin cell adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (Start-205)
      • conflict (97)
    • PDB 1GSM (206-209)
    Domains in SCOPe 2.06: d1gsma1, d1gsma2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gsmA (A:)
    qslqvkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsv
    ltvrnaslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahk
    vtpvdpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpv
    ppalycqatmrlpglelshrqaipvliegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gsmA (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpvppal
    ycqatmrlpglelshrqaipvliegr