PDB entry 1gsl

View 1gsl on RCSB PDB site
Description: lectin (fourth isolated from (griffonia simplicifolia)) complex with y human blood group determinant
Class: lectin
Keywords: glycoprotein, lectin, manganese, calcium
Deposited on 1996-06-15, released 1996-12-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1854
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: griffonia simplicifolia lectin 4
    Species: GRIFFONIA SIMPLICIFOLIA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gsla_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gslA (A:)
    entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
    flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
    sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
    rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
    tnk