PDB entry 1gsl

View 1gsl on RCSB PDB site
Description: lectin (fourth isolated from (griffonia simplicifolia)) complex with y human blood group determinant
Deposited on 1996-06-15, released 1996-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1854
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1gsl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsl_ (-)
    entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
    flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
    sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
    rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
    tnk