PDB entry 1gsk

View 1gsk on RCSB PDB site
Description: crystal structure of cota, an endospore coat protein from bacillus subtilis
Class: sporulation
Keywords: sporulation, laccase
Deposited on 2002-01-08, released 2003-05-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-05-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17866
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gska1, d1gska2, d1gska3
  • Heterogens: CU, C2O, C1O, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gskA (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gskA (A:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe
    qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklpsde
    ydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylevepr
    kyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiidfta
    yegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypsvqheriqn
    irtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvsf
    rvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgry
    vwhchilehedydmmrpmditd