PDB entry 1gsi

View 1gsi on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
Deposited on 2002-01-03, released 2002-03-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-28, with a file datestamp of 2002-03-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gsia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsiA (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatla