PDB entry 1gse

View 1gse on RCSB PDB site
Description: glutathione transferase a1-1 complexed with an ethacrynic acid glutathione conjugate (mutant r15k)
Class: transferase (glutathione)
Keywords: a1-1, transferase (glutathione)
Deposited on 1995-06-09, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (0-220)
      • conflict (13)
    Domains in SCOPe 2.07: d1gsea1, d1gsea2
  • Chain 'B':
    Compound: glutathione transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (0-220)
      • conflict (13)
    Domains in SCOPe 2.07: d1gseb1, d1gseb2
  • Heterogens: GSH, EAA, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gseA (A:)
    aekpklhyfnargkmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gseB (B:)
    aekpklhyfnargkmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf