PDB entry 1gs7

View 1gs7 on RCSB PDB site
Description: crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
Class: oxidoreductase
Keywords: oxidoreductase, multicopper, periplasmic
Deposited on 2002-01-02, released 2002-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.155
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-335)
      • engineered mutation (253)
    Domains in SCOP 1.75: d1gs7a1, d1gs7a2
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gs7A (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphliggfgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr