PDB entry 1gs6

View 1gs6 on RCSB PDB site
Description: crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
Class: oxidoreductase
Keywords: oxidoreductase, multicopper, periplasmic
Deposited on 2002-01-02, released 2002-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.15
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: nitrite reductase
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-335)
      • engineered mutation (143)
    Domains in SCOP 1.75: d1gs6x1, d1gs6x2
  • Heterogens: CU, MG, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gs6X (X:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgasgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr