PDB entry 1gs0

View 1gs0 on RCSB PDB site
Description: crystal structure of the catalytic fragment of murine poly (ADP-ribose) polymerase-2
Class: transferase
Keywords: transferase, crystal structure, catalytic fragment, polymerase transferase, nuclear protein, DNA-binding
Deposited on 2001-12-19, released 2002-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly (ADP-ribose) polymerase-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gs0a1, d1gs0a2
  • Chain 'B':
    Compound: poly (ADP-ribose) polymerase-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gs0b1, d1gs0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gs0A (A:)
    esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
    agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkse
    rqglehpldqhyrnlhcalrpldhesnefkvisqylqsthapthkdytmtlldvfeveke
    gekeafredlpnrmllwhgsrlsnwvgilshglrvappeapitgymfgkgiyfadmssks
    anycfasrlkntgllllsevalgqcnelleanpkaqgllrgkhstkgmgkmapspahfit
    lngstvplgpasdtgilnpegytlnynefivyspnqvrmryllkiqfnflq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gs0A (A:)
    esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
    agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkeh
    pldqhyrnlhcalrpldhesnefkvisqylqsthapthkdytmtlldvfevekegekeaf
    redlpnrmllwhgsrlsnwvgilshglrvappeapitgymfgkgiyfadmssksanycfa
    srlkntgllllsevalgqcnelleanpkaqgllrgkhstkgmgkmapspahfitlngstv
    plgpasdtgilnpegytlnynefivyspnqvrmryllkiqfnflq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gs0B (B:)
    esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir
    agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkse
    rqglehpldqhyrnlhcalrpldhesnefkvisqylqsthapthkdytmtlldvfeveke
    gekeafredlpnrmllwhgsrlsnwvgilshglrvappeapitgymfgkgiyfadmssks
    anycfasrlkntgllllsevalgqcnelleanpkaqgllrgkhstkgmgkmapspahfit
    lngstvplgpasdtgilnpegytlnynefivyspnqvrmryllkiqfnflq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gs0B (B:)
    qldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcirag
    qhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkehpl
    dqhyrnlhcalrpldhesnefkvisqylqsthapthkdytmtlldvfevekegekeafre
    dlpnrmllwhgsrlsnwvgilshglrvappeapitgymfgkgiyfadmssksanycfasr
    lkntgllllsevalgqcnelleanpkaqgllrgkhstkgmgkmapspahfitlngstvpl
    gpasdtgilnpegytlnynefivyspnqvrmryllkiqfnflq