PDB entry 1gry

View 1gry on RCSB PDB site
Description: crystal structure of human nicotinamide mononucleotide adenylyltransferase in complex with nmn
Class: transferase
Keywords: nad biosynthesis, adenylyltransferase
Deposited on 2001-12-18, released 2002-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-07-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.255
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grya_
  • Chain 'B':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gryb_
  • Chain 'C':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gryc_
  • Heterogens: NMN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gryA (A:)
    mrgshhhhhhgsensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiis
    pvgdaykkkglipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleas
    dcdhqqnsptlerpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlw
    kseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirra
    lrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gryA (A:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekavpkvkllcgadllesfavp
    nlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstki
    rralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilapl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gryB (B:)
    mrgshhhhhhgsensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiis
    pvgdaykkkglipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleas
    dcdhqqnsptlerpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlw
    kseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirra
    lrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gryB (B:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekavpkvkllcgadllesfavp
    nlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstki
    rralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilapl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gryC (C:)
    mrgshhhhhhgsensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiis
    pvgdaykkkglipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleas
    dcdhqqnsptlerpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlw
    kseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirra
    lrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gryC (C:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekavpkvkllcgadllesfavp
    nlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstki
    rralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilapl