PDB entry 1grx

View 1grx on RCSB PDB site
Description: structure of e. coli glutaredoxin
Deposited on 1993-10-01, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-24, with a file datestamp of 1998-06-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1grx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1grx_ (-)
mqtvifgrsgcpysvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
qifvdqqhiggytdfaawvkenlda