PDB entry 1grw

View 1grw on RCSB PDB site
Description: c. elegans major sperm protein
Class: cytosketal protein
Keywords: cytosketal protein, cytoskeleton, sperm, cell motility
Deposited on 2001-12-18, released 2002-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major sperm protein 31/40/142
    Species: CAENORHABDITIS ELEGANS [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grwa_
  • Chain 'B':
    Compound: major sperm protein 31/40/142
    Species: CAENORHABDITIS ELEGANS [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grwb_
  • Chain 'C':
    Compound: major sperm protein 31/40/142
    Species: CAENORHABDITIS ELEGANS [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grwc_
  • Chain 'D':
    Compound: major sperm protein 31/40/142
    Species: CAENORHABDITIS ELEGANS [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grwd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1grwA (A:)
    aqsvppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcg
    vldpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknl
    pieynp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grwA (A:)
    svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
    dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1grwB (B:)
    aqsvppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcg
    vldpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknl
    pieynp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grwB (B:)
    svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
    dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1grwC (C:)
    aqsvppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcg
    vldpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknl
    pieynp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grwC (C:)
    svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
    dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1grwD (D:)
    aqsvppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcg
    vldpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknl
    pieynp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grwD (D:)
    svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
    dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynp