PDB entry 1grq

View 1grq on RCSB PDB site
Description: chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Class: transferase
Keywords: transferase, kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold
Deposited on 2001-12-15, released 2002-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.278
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloramphenicol 3-o phosphotransferase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grqa_
  • Heterogens: SO4, CLK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1grqA (A:)
    mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
    gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
    cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp