PDB entry 1grn

View 1grn on RCSB PDB site
Description: crystal structure of the cdc42/cdc42gap/alf3 complex.
Class: gene regulation
Keywords: transition-state, g-protein, cdc42, gap, alf3, gene regulation
Deposited on 1998-07-30, released 1999-01-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.211
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1grna_
  • Chain 'B':
    Compound: protein (rho gtpase activating protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1grnb_
  • Heterogens: MG, GDP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1grnA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1grnB (B:)
    lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqqk
    ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
    lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
    ntftkflldhqgelfpspdpsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grnB (B:)
    lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqqk
    ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
    lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
    ntftkflldhqgelfps