PDB entry 1grl

View 1grl on RCSB PDB site
Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms
Deposited on 1995-03-07, released 1995-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.326
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1grl_ (-)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd