PDB entry 1grj

View 1grj on RCSB PDB site
Description: grea transcript cleavage factor from escherichia coli
Deposited on 1995-05-02, released 1995-07-10
The last revision prior to the SCOP 1.71 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1grj_ (-)
    mqaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfceg
    rikdieaklsnaqvidvtkmpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnli
    svnspiargligkeeddvvviktpggevefevikveyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grj_ (-)
    qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
    ikdieaklsnaqvidvtkmpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnlis
    vnspiargligkeeddvvvivefevikveyl