PDB entry 1grj

View 1grj on RCSB PDB site
Description: grea transcript cleavage factor from escherichia coli
Class: transcription regulation
Keywords: transcript elongation factor, transcript cleavage factor, transcription regulation
Deposited on 1995-05-02, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: grea protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grja1, d1grja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1grjA (A:)
    mqaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfceg
    rikdieaklsnaqvidvtkmpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnli
    svnspiargligkeeddvvviktpggevefevikveyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grjA (A:)
    qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
    ikdieaklsnaqvidvtkmpnngrvifgatvtvlnldsdeeqtyrivgddeadfkqnlis
    vnspiargligkeeddvvvivefevikveyl