PDB entry 1grc

View 1grc on RCSB PDB site
Description: crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy
Class: transferase(formyl)
Keywords: transferase(formyl)
Deposited on 1992-07-21, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.19
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycinamide ribonucleotide transformylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grca_
  • Chain 'B':
    Compound: glycinamide ribonucleotide transformylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1grcb_
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1grcA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grcA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpdeehgts
    vhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhena
    awldgqrlppqgya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1grcB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grcB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkhgtsvh
    fvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaaw
    ldgqrlppqgya