PDB entry 1gr7

View 1gr7 on RCSB PDB site
Description: crystal structure of the double mutant cys3ser/ser100pro from pseudomonas aeruginosa at 1.8 a resolution
Class: electron transport
Keywords: electron transport
Deposited on 2001-12-14, released 2002-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17651
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • engineered mutation (2)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d1gr7a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • engineered mutation (2)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d1gr7b_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • engineered mutation (2)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d1gr7c_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • engineered mutation (2)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d1gr7d_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gr7A (A:)
    aessvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gr7A (A:)
    essvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gr7B (B:)
    aessvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gr7B (B:)
    ssvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
    gmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsalmk
    gtltlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gr7C (C:)
    aessvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gr7C (C:)
    ssvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
    gmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsalmk
    gtltlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gr7D (D:)
    aessvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gr7D (D:)
    essvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsalm
    kgtltlk