PDB entry 1gr1

View 1gr1 on RCSB PDB site
Description: structure of ferredoxin-nadp+ reductase with glu 139 replaced by lys (e139k)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, fad, fnr, nadp+ reductase
Deposited on 2001-12-12, released 2002-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin--nadp+ reductase
    Species: NOSTOC SP. PCC7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-302)
      • engineered mutation (138)
      • conflict (245)
    Domains in SCOPe 2.06: d1gr1a1, d1gr1a2
  • Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gr1A (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkkmllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gr1A (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkkmllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety