PDB entry 1gr0

View 1gr0 on RCSB PDB site
Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.
Class: isomerase
Keywords: isomerase, oxidoreductase, psi, protein structure initiative, tb structural genomics consortium, tb, tbsgc
Deposited on 2001-12-10, released 2002-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol-3-phosphate synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gr0a1, d1gr0a2
  • Heterogens: NAD, ZN, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gr0A (A:)
    msehqslpapeastevrvaivgvgncasslvqgveyyynaddtstvpglmhvrfgpyhvr
    dvkfvaafdvdakkvgfdlsdaifasenntikiadvaptnvivqrgptldgigkyyadti
    elsdaepvdvvqalkeakvdvlvsylpvgseeadkfyaqcaidagvafvnalpvfiasdp
    vwakkftdarvpivgddiksqvgatithrvlaklfedrgvqldrtmqlnvggnmdflnml
    ererleskkisktqavtsnlkrefktkdvhigpsdhvgwlddrkwayvrlegrafgdvpl
    nleyklevwdspnsagviidavraakiakdrgiggpvipasaylmksppeqlpddiaraq
    leefiig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gr0A (A:)
    tevrvaivgvgncasslvqgveyyynaddtstvpglmhvrfgpyhvrdvkfvaafdvdak
    kvgfdlsdaifasenntikiadvaptnvivqrgptldgigkyyadtielsdaepvdvvqa
    lkeakvdvlvsylpvgseeadkfyaqcaidagvafvnalpvfiasdpvwakkftdarvpi
    vgddiksqvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmledvhigpsdhvgw
    lddrkwayvrlegrafgdvplnleyklevwdspnsagviidavraakiakdrgiggpvip
    asaylmksppeqlpddiaraqleefiig