PDB entry 1gqz

View 1gqz on RCSB PDB site
Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a
Class: isomerase
Keywords: peptidoglycan biosynthesis, isomerase
Deposited on 2001-12-07, released 2003-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-06-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.16652
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Haemophilus influenzae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gqza1, d1gqza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqzA (A:)
    mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
    rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
    piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
    sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
    dlpggslmiewngvghplymtgeathiydgfitl