PDB entry 1gqz

View 1gqz on RCSB PDB site
Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a
Deposited on 2001-12-07, released 2003-06-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-05, with a file datestamp of 2004-02-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.16652
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqzA (A:)
    mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
    rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
    piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
    sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
    dlpggslmiewngvghplymtgeathiydgfitl