PDB entry 1gqj

View 1gqj on RCSB PDB site
Description: structure of pseudomonas cellulosa alpha-d-glucuronidase complexed with xylobiose
Deposited on 2001-11-26, released 2002-09-26
The last revision prior to the SCOP 1.67 freeze date was dated 2002-09-26, with a file datestamp of 2002-09-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17273
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqjA (A:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsegqpgpqgygrdh
    aeganmlaaalkpfggvvfwrafvyhpdiedrfrgaydefmpldgkfadnvilqikngpi
    dfqprepfsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegst
    ignilegkvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadew
    lrmtfsnqpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwt
    avyyhrasktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqs
    grnlwqelvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscv
    lyfqsvagrpipanyeqpehdleyykmlarttyvpepwhpasssrvlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqjB (B:)
    edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
    deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
    lygsfhllrliqtqhaleklslssaprlqhrvvnhwdnlnrvvergyaglslwdwgslpn
    ylaprytdyarinaslgingtvinnvnadprvlsdqflqkiaaladafrpygikmylsin
    fnsprafgdvdtadpldprvqqwwktraqkiysyipdfggflvkadsegqpgpqgygrdh
    aeganmlaaalkpfggvvfwrafvyhpdiedrfrgaydefmpldgkfadnvilqikngpi
    dfqprepfsalfagmsrtnmmmefqitqeyfgfathlayqgplfeeslktethargegst
    ignilegkvfktrhtgmagvinpgtdrnwtghpfvqsswyafgrmawdhqisaataadew
    lrmtfsnqpafiepvkqmmlvsreagvnyrsplglthlysqgdhygpapwtddlpradwt
    avyyhrasktgigfnrtktgsnalaqypepiakawgdlnsvpedlilwfhhlswdhrmqs
    grnlwqelvhkyyqgveqvramqrtwdqqeayvdaarfaqvkallqvqereavrwrnscv
    lyfqsvagrpipanyeqpehdleyykmlarttyvpepwhpasssrvlk