PDB entry 1gqe

View 1gqe on RCSB PDB site
Description: polypeptide chain release factor 2 (rf2) from escherichia coli
Deposited on 2001-11-22, released 2002-04-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-04, with a file datestamp of 2002-04-04.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.222
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gqea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqeA (A:)
    inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
    eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
    dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
    sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
    yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
    naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
    gl