PDB entry 1gqe

View 1gqe on RCSB PDB site
Description: polypeptide chain release factor 2 (rf2) from escherichia coli
Class: translation
Keywords: protein synthesis, ribosome, macromolecular mimicry, translation
Deposited on 2001-11-22, released 2002-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.222
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: release factor 2
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07012 (Start-364)
      • engineered mutation (245)
      • conflict (297)
    Domains in SCOPe 2.08: d1gqea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gqeA (A:)
    mfeinpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgker
    ssleavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfs
    geydsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvt
    ikisgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlr
    idvyrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevem
    qkknaekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieas
    lkagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gqeA (A:)
    inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
    eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
    dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
    sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
    yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
    naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
    gl