PDB entry 1gq9

View 1gq9 on RCSB PDB site
Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with ctp at 100k
Class: transferase
Keywords: transferase, nucleotidyltransferase, cmp-kdo synthetase, nucleoside monophosphate glycosides, lipopolysaccharide biosynthesis, sugar-activating enzymes
Deposited on 2001-11-21, released 2002-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gq9a_
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gq9b_
  • Heterogens: MG, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gq9A (A:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gq9A (A:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gq9B (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gq9B (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    l