PDB entry 1gq5

View 1gq5 on RCSB PDB site
Description: structural determinants of the nherf interaction with beta2-ar and pdgfr
Class: signaling protein
Keywords: signaling protein, pdz, beta2-adrenergic receptor, pdgfr, nherf, crystal structure, complex
Deposited on 2001-11-20, released 2002-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ezrin-radixin-moesin binding phosphoprotein-50
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GQ5 (0-1)
    • Uniprot O14745 (2-85)
    • Uniprot P09619 (86-90)
    Domains in SCOPe 2.07: d1gq5a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq5A (A:)
    gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
    kethqqvvsriraalnavrllvvdpeedsfl