PDB entry 1gq4

View 1gq4 on RCSB PDB site
Description: structural determinants of the nherf interaction with beta2ar and pdgfr
Deposited on 2001-11-19, released 2002-05-21
The last revision prior to the SCOP 1.71 freeze date was dated 2002-05-21, with a file datestamp of 2002-05-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17154
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1gq4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gq4A (A:)
  mlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenvek
  ethqqvvsriraalnavrllvvdpendsll