PDB entry 1gq4

View 1gq4 on RCSB PDB site
Description: structural determinants of the nherf interaction with beta2ar and pdgfr
Class: signaling protein
Keywords: signaling protein, pdz, beta2-adrenergic receptor, pdgfr, nherf, complex
Deposited on 2001-11-19, released 2002-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ezrin-radixin-moesin binding phosphoprotein-50
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GQ4 (0-0)
    • Uniprot O14745 (1-84)
    • Uniprot P07550 (85-89)
    Domains in SCOPe 2.07: d1gq4a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq4A (A:)
    mlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenvek
    ethqqvvsriraalnavrllvvdpendsll