PDB entry 1gq2

View 1gq2 on RCSB PDB site
Description: malic enzyme from pigeon liver
Class: oxidoreductase
Keywords: oxidoreductase, malic enzyme, pigeon liver, nadp-dependent, crystal structure, nad-nadp selectivity, decarboxylase, malate, mn2+
Deposited on 2001-11-19, released 2002-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2a1, d1gq2a2
  • Chain 'B':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2b1, d1gq2b2
  • Chain 'C':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2c1, d1gq2c2
  • Chain 'D':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2d1, d1gq2d2
  • Chain 'E':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2e1, d1gq2e2
  • Chain 'F':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2f1, d1gq2f2
  • Chain 'G':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2g1, d1gq2g2
  • Chain 'H':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2h1, d1gq2h2
  • Chain 'I':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2i1, d1gq2i2
  • Chain 'J':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2j1, d1gq2j2
  • Chain 'K':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2k1, d1gq2k2
  • Chain 'L':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2l1, d1gq2l2
  • Chain 'M':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2m1, d1gq2m2
  • Chain 'N':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2n1, d1gq2n2
  • Chain 'O':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2o1, d1gq2o2
  • Chain 'P':
    Compound: malic enzyme
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40927 (0-554)
      • modified residue (15)
      • modified residue (63)
      • modified residue (85)
      • modified residue (123)
      • modified residue (154)
      • modified residue (179)
      • modified residue (216)
      • modified residue (225)
      • modified residue (302)
      • modified residue (304)
      • modified residue (320)
      • modified residue (348)
      • modified residue (381)
      • modified residue (551)
    Domains in SCOPe 2.07: d1gq2p1, d1gq2p2
  • Heterogens: NAP, OXL, MN, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2A (A:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2B (B:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2C (C:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2D (D:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2E (E:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2F (F:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2G (G:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2H (H:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2I (I:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2J (J:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2K (K:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2L (L:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2M (M:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2N (N:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2O (O:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gq2P (P:)
    kkgyevlrdphlnkgmaftleerqqlnihgllppcflgqdaqvysilknferltsdldry
    illmslqdrneklfykvltsdierfmpivytptvglacqhyglafrrprglfitihdrgh
    iatmlqswpesvikaivvtdgerilglgdlgcygmgipvgklalytacggvkphqclpvm
    ldvgtdnetllkdplyiglrhkrirgqayddlldefmeavtsrygmncliqfedfanana
    frllhkyrnkyctfnddiqgtasvavagllaalritknrlsdhtvlfqgageaalgianl
    ivmamqkegvskeeaikriwmvdskglivkgrasltpekehfahehcemknledivkdik
    ptvligvaaiggaftqqilqdmaafnkrpiifalsnptskaectaeqlykytegrgifas
    gspfdpvtlpsgqtlypgqgnnsyvfpgvalgviscglkhigddvflttaeviaqevsee
    nlqegrlypplvtiqqvslkiavriakeayrnntastypqpedleafirsqvystdyncf
    vadsytwpeeamkvk