PDB entry 1gq1

View 1gq1 on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, y25s mutant, oxidised form
Class: oxidoreductase
Keywords: reductase, enzyme, nitrite reductase, oxidoreductase, denitrification, electron transport, periplasmic
Deposited on 2001-11-19, released 2002-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.159
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome cd1 nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCQ0 (Start-566)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d1gq1a1, d1gq1a2
  • Chain 'B':
    Compound: cytochrome cd1 nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCQ0 (Start-566)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d1gq1b1, d1gq1b2
  • Heterogens: HEC, DHE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gq1A (A:)
    qeqvappkdpaaaledhktrtdnrsepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gq1A (A:)
    dpaaaledhktrtdnrsepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatye
    iksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gq1B (B:)
    qeqvappkdpaaaledhktrtdnrsepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gq1B (B:)
    dpaaaledhktrtdnrsepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatye
    iksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty