PDB entry 1gpx

View 1gpx on RCSB PDB site
Description: c85s gapdx, nmr, 20 structures
Class: electron transport
Keywords: electron transport, gapdx c85s, 20 structures aligned and sa
Deposited on 1998-06-10, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • mutation (84)
    Domains in SCOPe 2.07: d1gpxa_
  • Heterogens: GA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpxA (A:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlecvtaelkpnsrlscqiimtpeldgivvdvpdrqw