PDB entry 1gps

View 1gps on RCSB PDB site
Description: solution structure of gamma 1-h and gamma 1-p thionins from barley and wheat endosperm determined by 1h-nmr: a structural motif common to toxic arthropod proteins
Class: plant toxin
Keywords: plant toxin
Deposited on 1992-07-29, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gamma-1-p thionin
  Species: Triticum turgidum [TaxId:4571]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20158 (0-46)
  Domains in SCOPe 2.05: d1gpsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gpsA (A:)
  kicrrrsagfkgpcmsnkncaqvcqqegwgggncdgpfrrckcirqc