PDB entry 1gpp

View 1gpp on RCSB PDB site
Description: crystal structure of the s.cerevisiae homing endonuclease pi-scei domain i
Deposited on 2001-11-07, released 2002-09-19
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-19, with a file datestamp of 2002-09-19.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.1527
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1gppa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gppA (A:)
    mhhhhhhgsacfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgsetmysv
    vqksqhrahksdssrempellkftcnathelvvrtprsvrrlsrtikgveyfevitfemg
    qkkapdgrivelvkevsksypvsegperanelvesyrkasnkayfewtieardlsllgsh
    vrkatyqtyapigaafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gppA (A:)
    sacfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgsetmysvvqksmpel
    lkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsksy
    pvsegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyapigaafarec
    rgfyfelqelkeddyygitlsddsdhqfllanqvvvh