PDB entry 1gpo

View 1gpo on RCSB PDB site
Description: crystal structure of the rationally designed antibody m41 as a fab fragment
Deposited on 1997-03-27, released 1998-04-01
The last revision prior to the SCOP 1.65 freeze date was dated 1998-04-01, with a file datestamp of 1998-04-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gpoH (H:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdchhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoH (H:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gpoI (I:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdchhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoI (I:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1gpoL (L:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoL (L:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1gpoM (M:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoM (M:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne