PDB entry 1gpo

View 1gpo on RCSB PDB site
Description: crystal structure of the rationally designed antibody m41 as a fab fragment
Class: immune system
Keywords: protein engineering, antibody design, immunoglobulin structure, antigen-binding site, canonical conformation, complementarity-determining region, immune system
Deposited on 1997-03-27, released 1998-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody m41
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAC21717 (0-End)
      • conflict (2)
      • conflict (31-32)
      • conflict (34)
      • conflict (38)
      • conflict (43)
      • conflict (49-51)
      • conflict (53)
      • conflict (55)
      • conflict (57)
      • conflict (63)
      • conflict (80)
      • conflict (91)
      • conflict (93)
      • conflict (96-98)
      • conflict (108)
    Domains in SCOPe 2.07: d1gpoh1, d1gpoh2
  • Chain 'I':
    Compound: antibody m41
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAC21717 (0-End)
      • conflict (2)
      • conflict (31-32)
      • conflict (34)
      • conflict (38)
      • conflict (43)
      • conflict (49-51)
      • conflict (53)
      • conflict (55)
      • conflict (57)
      • conflict (63)
      • conflict (80)
      • conflict (91)
      • conflict (93)
      • conflict (96-98)
      • conflict (108)
    Domains in SCOPe 2.07: d1gpoi1, d1gpoi2
  • Chain 'L':
    Compound: antibody m41
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gpol1, d1gpol2
  • Chain 'M':
    Compound: antibody m41
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gpom1, d1gpom2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gpoH (H:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdchhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoH (H:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gpoI (I:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdchhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoI (I:)
    evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
    pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1gpoL (L:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoL (L:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1gpoM (M:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpoM (M:)
    dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
    sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne