PDB entry 1gpl

View 1gpl on RCSB PDB site
Description: rp2 lipase
Class: serine esterase
Keywords: serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric
Deposited on 1996-07-13, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rp2 lipase
    Species: Cavia porcellus [TaxId:10141]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16233 (0-431)
      • conflict (326)
      • conflict (333-335)
      • conflict (337)
      • conflict (339)
      • conflict (341)
      • conflict (343)
      • conflict (345-346)
      • conflict (350)
      • conflict (353-354)
      • conflict (363-366)
      • conflict (368-369)
      • conflict (371-374)
      • conflict (377-378)
      • conflict (380)
      • conflict (382)
      • conflict (384)
      • conflict (386-389)
      • conflict (391-394)
      • conflict (396-397)
      • conflict (401)
      • conflict (403)
      • conflict (405-408)
      • conflict (410-412)
      • conflict (417-419)
      • conflict (421)
      • conflict (423)
      • conflict (425-426)
      • conflict (429)
    Domains in SCOPe 2.07: d1gpla1, d1gpla2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gplA (A:)
    aevcyshlgcfsdekpwagtsqrpikslpsdpkkintrfllytnenqnsyqlitatdiat
    ikasnfnlnrktrfiihgftdsgenswlsdmcknmfqvekvncicvdwkggskaqysqas
    qnirvvgaevaylvqvlstslnyapenvhiighslgahtageagkrlnglvgritgldpa
    epyfqdtpeevrldpsdakfvdvihtdispilpslgfgmsqkvghmdffpnggkdmpgck
    tgiscnhhrsieyyhssilnpegflgypcasydefqesgcfpcpakgcpkmghfadqypg
    ktnaveqtfflntgasdnftrwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtl
    kpdsthsnefdsdvdvgdlqmvkfiwynnvinptlprvgaskiivetnvgkqfnfcspet
    vreevlltltpc