PDB entry 1gpe

View 1gpe on RCSB PDB site
Description: glucose oxidase from penicillium amagasakiense
Class: oxidoreductase(flavoprotein)
Keywords: oxidoreductase(flavoprotein)
Deposited on 1999-03-24, released 1999-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glucose oxidase)
    Species: PENICILLIUM AMAGASAKIENSE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gpea1, d1gpea2
  • Chain 'B':
    Compound: protein (glucose oxidase)
    Species: PENICILLIUM AMAGASAKIENSE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gpeb1, d1gpeb2
  • Heterogens: NAG, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpeA (A:)
    ylpaqqidvqssllsdpskvagktydyiiagggltgltvaakltenpkikvlviekgfye
    sndgaiiedpnaygqifgttvdqnyltvplinnrtnnikagkglggstlingdswtrpdk
    vqidswekvfgmegwnwdnmfeymkkaeaartptaaqlaaghsfnatchgtngtvqsgar
    dngqpwspimkalmntvsalgvpvqqdflcghprgvsmimnnldenqvrvdaarawllpn
    yqrsnleiltgqmvgkvlfkqtasgpqavgvnfgtnkavnfdvfakhevllaagsaispl
    ileysgiglksvldqanvtqlldlpvginmqdqttttvssrassagagqgqavffanfte
    tfgdyapqardllntkldqwaeetvarggfhnvtalkvqyenyrnwlldedvafaelfmd
    tegkinfdlwdlipftrgsvhilssdpylwqfandpkfflnefdllgqaaasklardlts
    qgamkeyfagetlpgynlvqnatlsqwsdyvlqnfrpnwhavsscsmmsrelggvvdata
    kvygtqglrvidgsipptqvsshvmtifygmalkvadailddyaksa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpeB (B:)
    ylpaqqidvqssllsdpskvagktydyiiagggltgltvaakltenpkikvlviekgfye
    sndgaiiedpnaygqifgttvdqnyltvplinnrtnnikagkglggstlingdswtrpdk
    vqidswekvfgmegwnwdnmfeymkkaeaartptaaqlaaghsfnatchgtngtvqsgar
    dngqpwspimkalmntvsalgvpvqqdflcghprgvsmimnnldenqvrvdaarawllpn
    yqrsnleiltgqmvgkvlfkqtasgpqavgvnfgtnkavnfdvfakhevllaagsaispl
    ileysgiglksvldqanvtqlldlpvginmqdqttttvssrassagagqgqavffanfte
    tfgdyapqardllntkldqwaeetvarggfhnvtalkvqyenyrnwlldedvafaelfmd
    tegkinfdlwdlipftrgsvhilssdpylwqfandpkfflnefdllgqaaasklardlts
    qgamkeyfagetlpgynlvqnatlsqwsdyvlqnfrpnwhavsscsmmsrelggvvdata
    kvygtqglrvidgsipptqvsshvmtifygmalkvadailddyaksa