PDB entry 1gpe

View 1gpe on RCSB PDB site
Description: glucose oxidase from penicillium amagasakiense
Deposited on 1999-03-24, released 1999-05-06
The last revision prior to the SCOP 1.57 freeze date was dated 1999-05-06, with a file datestamp of 1999-05-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpeA (A:)
    ylpaqqidvqssllsdpskvagktydyiiagggltgltvaakltenpkikvlviekgfye
    sndgaiiedpnaygqifgttvdqnyltvplinnrtnnikagkglggstlingdswtrpdk
    vqidswekvfgmegwnwdnmfeymkkaeaartptaaqlaaghsfnatchgtngtvqsgar
    dngqpwspimkalmntvsalgvpvqqdflcghprgvsmimnnldenqvrvdaarawllpn
    yqrsnleiltgqmvgkvlfkqtasgpqavgvnfgtnkavnfdvfakhevllaagsaispl
    ileysgiglksvldqanvtqlldlpvginmqdqttttvssrassagagqgqavffanfte
    tfgdyapqardllntkldqwaeetvarggfhnvtalkvqyenyrnwlldedvafaelfmd
    tegkinfdlwdlipftrgsvhilssdpylwqfandpkfflnefdllgqaaasklardlts
    qgamkeyfagetlpgynlvqnatlsqwsdyvlqnfrpnwhavsscsmmsrelggvvdata
    kvygtqglrvidgsipptqvsshvmtifygmalkvadailddyaksa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpeB (B:)
    ylpaqqidvqssllsdpskvagktydyiiagggltgltvaakltenpkikvlviekgfye
    sndgaiiedpnaygqifgttvdqnyltvplinnrtnnikagkglggstlingdswtrpdk
    vqidswekvfgmegwnwdnmfeymkkaeaartptaaqlaaghsfnatchgtngtvqsgar
    dngqpwspimkalmntvsalgvpvqqdflcghprgvsmimnnldenqvrvdaarawllpn
    yqrsnleiltgqmvgkvlfkqtasgpqavgvnfgtnkavnfdvfakhevllaagsaispl
    ileysgiglksvldqanvtqlldlpvginmqdqttttvssrassagagqgqavffanfte
    tfgdyapqardllntkldqwaeetvarggfhnvtalkvqyenyrnwlldedvafaelfmd
    tegkinfdlwdlipftrgsvhilssdpylwqfandpkfflnefdllgqaaasklardlts
    qgamkeyfagetlpgynlvqnatlsqwsdyvlqnfrpnwhavsscsmmsrelggvvdata
    kvygtqglrvidgsipptqvsshvmtifygmalkvadailddyaksa