PDB entry 1gpd

View 1gpd on RCSB PDB site
Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase
Class: oxido-reductse(aldehyde/donr,nad/accpt)
Keywords: oxido-reductse(aldehyde/donr,nad/accpt)
Deposited on 1975-07-01, released 1977-02-17
The last revision prior to the SCOP 1.75 freeze date was dated 1992-07-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homarus americanus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gpdg1, d1gpdg2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homarus americanus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gpdr1, d1gpdr2
  • Heterogens: PO4, ACE, NAD

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpdG (G:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpdR (R:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa