PDB entry 1gpd

View 1gpd on RCSB PDB site
Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase
Deposited on 1975-07-01, released 1977-02-17
The last revision prior to the SCOP 1.65 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpdG (G:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpdR (R:)
    skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
    sadapmfvcgvnlekyskdmtvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpdvsvvd
    ltvrlgkecsyddikaamktasegplqgflgyteddvvssdfigdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidllkhmqkvdsa