PDB entry 1gp6

View 1gp6 on RCSB PDB site
Description: Anthocyanidin synthase from Arabidopsis thaliana complexed with trans-dihydroquercetin (with 30 min exposure to O2)
Deposited on 2001-10-30, released 2002-02-21
The last revision prior to the SCOP 1.67 freeze date was dated 2002-02-21, with a file datestamp of 2002-02-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1gp6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gp6A (A:)
    mvaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesdde
    kirencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatg
    kiqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrlla
    tkvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltf
    ilhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvris
    wavfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeqeelvseknd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gp6A (A:)
    vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek
    irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk
    iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat
    kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi
    lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw
    avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeqeel