PDB entry 1gp1

View 1gp1 on RCSB PDB site
Description: the refined structure of the selenoenzyme glutathione peroxidase at 0.2-nm resolution
Class: oxidoreductase(h2o2(a))
Keywords: oxidoreductase(h2o2(a))
Deposited on 1985-06-11, released 1985-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione peroxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00435
      • conflict (44)
    Domains in SCOPe 2.07: d1gp1a_
  • Chain 'B':
    Compound: glutathione peroxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00435
      • conflict (44)
    Domains in SCOPe 2.07: d1gp1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gp1A (A:)
    aaalaaaaprtvyafsarplaggepfnlsslrgkvllienvaslxgttvrdytqmndlqr
    rlgprglvvlgfpcnqfghqenakneeilnclkyvrpgggfepnfmlfekcevngekahp
    lfaflrevlptpsddatalmtdpkfitwspvcrndvswnfekflvgpdgvpvrrysrrfl
    tidiepdietllsqgasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gp1A (A:)
    rtvyafsarplaggepfnlsslrgkvllienvaslxgttvrdytqmndlqrrlgprglvv
    lgfpcnqfghqenakneeilnclkyvrpgggfepnfmlfekcevngekahplfaflrevl
    ptpsddatalmtdpkfitwspvcrndvswnfekflvgpdgvpvrrysrrfltidiepdie
    tllsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gp1B (B:)
    aaalaaaaprtvyafsarplaggepfnlsslrgkvllienvaslxgttvrdytqmndlqr
    rlgprglvvlgfpcnqfghqenakneeilnclkyvrpgggfepnfmlfekcevngekahp
    lfaflrevlptpsddatalmtdpkfitwspvcrndvswnfekflvgpdgvpvrrysrrfl
    tidiepdietllsqgasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gp1B (B:)
    rtvyafsarplaggepfnlsslrgkvllienvaslxgttvrdytqmndlqrrlgprglvv
    lgfpcnqfghqenakneeilnclkyvrpgggfepnfmlfekcevngekahplfaflrevl
    ptpsddatalmtdpkfitwspvcrndvswnfekflvgpdgvpvrrysrrfltidiepdie
    tllsq