PDB entry 1gow

View 1gow on RCSB PDB site
Description: beta-glycosidase from sulfolobus solfataricus
Deposited on 1996-09-19, released 1997-08-20
The last revision prior to the SCOP 1.63 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gowa_
  • Chain 'B':
    Domains in SCOP 1.63: d1gowb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gowA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gowB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnsewsrqfpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfiqnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsaytawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh