PDB entry 1got

View 1got on RCSB PDB site
Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Deposited on 1996-08-07, released 1997-03-12
The last revision prior to the SCOP 1.65 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: -1.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gotA (A:)
    mgagasaeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysle
    eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
    diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
    ietqfsfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
    esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyik
    vqflelnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiikenlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gotA (A:)
    saeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysleeclef
    iaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkemsdiiqr
    lwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgiietqf
    sfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
    fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyikvqfle
    lnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiiken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gotB (B:)
    mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
    mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
    csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
    tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
    fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
    kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gotB (B:)
    seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
    hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
    siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
    ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
    atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
    adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gotG (G:)
    mpviniedpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedpl
    vkgipedknpfke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gotG (G:)
    ltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke