PDB entry 1gos

View 1gos on RCSB PDB site
Description: human monoamine oxidase b
Deposited on 2001-10-26, released 2001-11-29
The last revision prior to the SCOP 1.65 freeze date was dated 2001-11-29, with a file datestamp of 2001-11-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gosA (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gosA (A:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gosB (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gosB (B:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrli