PDB entry 1gol

View 1gol on RCSB PDB site
Description: coordinates of rat map kinase erk2 with an arginine mutation at position 52
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, ATP-binding, cell cycle, phosphorylation
Deposited on 1996-01-23, released 1997-03-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extracellular regulated kinase 2
    Species: Rattus norvegicus
    Gene: ERK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63086 (Start-363)
      • engineered (57)
    Domains in SCOP 1.73: d1gola_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1golA (A:)
    hhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvairki
    spfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykll
    ktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadp
    dhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldq
    lnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltf
    nphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp
    gyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1golA (A:)
    aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvairkispfehqt
    ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
    dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
    lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
    lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
    veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs