PDB entry 1goe

View 1goe on RCSB PDB site
Description: monitoring the structural consequences of phe12-->d-phe12 and leu15-->aib15 substitution in h/r corticotropin releasing hormone: implications for design of crh antagonists.
Deposited on 2001-10-20, released 2001-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-31, with a file datestamp of 2001-10-31.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1goea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1goeA (A:)
    seeppisldltfhlarevlemaraeqlaqqahsnrklmeii